PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB04G27810.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 461aa    MW: 50337.9 Da    PI: 8.6979
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB04G27810.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding391.8e-12144189146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g+WT+eEde l++ v+ +G+ +W++I ++  + Rt+k+c++rw +
     OB04G27810.1 144 KGPWTAEEDEVLLQHVRAHGPMDWSSIRSKGLLPRTGKSCRLRWVN 189
                      79******************99*****8876677**********87 PP

2Myb_DNA-binding40.66.1e-13200240345
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      ++++eE+   +++  q+G++ W++Ia +++ gRt++++k++w 
     OB04G27810.1 200 KFSAEEERVVIELQSQFGNK-WARIATYLQ-GRTDNDVKNFWS 240
                      79******************.*********.***********5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.039139195IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-19141192IPR009057Homeodomain-like
SuperFamilySSF466897.86E-27142239IPR009057Homeodomain-like
SMARTSM007174.6E-11143193IPR001005SANT/Myb domain
CDDcd001671.67E-11146191No hitNo description
PfamPF139213.7E-12147197No hitNo description
Gene3DG3DSA:1.10.10.603.4E-17193245IPR009057Homeodomain-like
PROSITE profilePS5129417.644196247IPR017930Myb domain
SMARTSM007173.3E-11197245IPR001005SANT/Myb domain
CDDcd001672.00E-9200239No hitNo description
PfamPF002493.2E-11200240IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048235Biological Processpollen sperm cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 461 aa     Download sequence    Send to blast
MAAAASETTV PTRKSLSSLC ARGHEARGIR RSWWWWWWRG GCLRIAISCS CAPSRIKPGR  60
PIPAGRSPSR HAHHYAGCRD THREEARSIV IHRSRIRTTH CPALAFACVG AAAAAAEAMA  120
RAPGGVRRRS ARRDAAGGGD AVRKGPWTAE EDEVLLQHVR AHGPMDWSSI RSKGLLPRTG  180
KSCRLRWVNK LRPNLKSGCK FSAEEERVVI ELQSQFGNKW ARIATYLQGR TDNDVKNFWS  240
TRQKRLARLL RAPLPARSNK QNSSKGKAPS SSSLESPTAT TFHQGPACLD QASFEGNSFG  300
CHYCEAAPFM EHQNVARAPY DQACSGFFAF EGALPLQFLA PADGEASSSN AAHQLAPPLP  360
FDPPLYPLVE LPGWTDRCVE AGNGFVDAGA MDDLAYQELL PMVQAAPMMM PFFGMECAHE  420
AIKGEPRDAF GDLPPNMFDD NLDQLPSSPP SPPSPSGGDE F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C7e-2514224525126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL6630006e-76AL663000.4 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBb0034G17, complete sequence.
GenBankAL7316136e-76AL731613.5 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBa0065H10, complete sequence.
GenBankAP0149606e-76AP014960.1 Oryza sativa Japonica Group DNA, chromosome 4, cultivar: Nipponbare, complete sequence.
GenBankCP0126126e-76CP012612.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 4 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015692198.10.0PREDICTED: uncharacterized protein LOC102701723
TrEMBLJ3M0560.0J3M056_ORYBR; Uncharacterized protein
STRINGOB04G27810.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57003357
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60460.15e-57MYB family protein